Bacillus sonorensis: S101395_00492 Help Entry S101395_00492     CDS       T06571                                  Name (GenBank) Protein MbtH   KO K05375   MbtH protein Organism bson  Bacillus sonorensis Pathway bson00261   Monobactam biosynthesis bson01100   Metabolic pathways bson01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bson00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     S101395_00492  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bson01008]     S101395_00492 Polyketide biosynthesis proteins [BR:bson01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     S101395_00492 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH DUF3256 Motif Other DBs NCBI-ProteinID:  ASB87047 LinkDB All DBs Position 464444..464671 Genome browser AA seq 75 aa AA seqDB search MMTNPFENEDGTYVVLMNSEGQYSLWPAFIDVPSGWAAVFGEANRSDCVEYISSNWSDLR PNSLKPALGVHGGED NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgatgacgaatccttttgaaaatgaagacggcacatatgttgtcctgatgaatagcgaa ggccagtattcgctctggccggcttttattgatgtgccgtccggctgggccgctgtcttt ggtgaagcaaatcgaagcgattgtgttgaatatattagctcaaattggagcgatcttcgt ccgaacagcctgaagccagcactcggggttcacggcggtgaagactga

DBGET integrated database retrieval system