Bacillus subtilis PY79: U712_15920 Help Entry U712_15920        CDS       T02937                                  Name (GenBank) Uncharacterized protein ybdZ   KO K05375   MbtH protein Organism bsp  Bacillus subtilis PY79 Pathway bsp00261   Monobactam biosynthesis bsp01100   Metabolic pathways bsp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bsp00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     U712_15920  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bsp01008]     U712_15920 Polyketide biosynthesis proteins [BR:bsp01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     U712_15920 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AHA79121 LinkDB All DBs Position complement(3098148..3098357) Genome browser AA seq 69 aa AA seqDB search MANPFENADGTYLVLVNEEGQYSLWPGFIDVPSGWTVVHEQKGREACLDYIQSHWSDMRP NSLKTVENV NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggcaaatccttttgaaaatgcggatggcacatatttggtgctggtcaatgaagaaggc caatattccctatggccgggttttatagatgtgccgagcggctggacagtcgttcatgag caaaaagggcgtgaagcttgtttggactatatccaatcgcattggagcgatatgaggcca aacagcctaaagactgttgaaaatgtgtaa

DBGET integrated database retrieval system