Bacteroides stercoris: K6V31_00325 Help Entry K6V31_00325       CDS       T07883                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism bste  Bacteroides stercoris Pathway bste00020   Citrate cycle (TCA cycle) bste01100   Metabolic pathways bste01110   Biosynthesis of secondary metabolites bste01120   Microbial metabolism in diverse environments bste01200   Carbon metabolism bste01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:bste00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     K6V31_00325 Enzymes [BR:bste01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      K6V31_00325 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_2 Fer4_21 Fer4_6 Fer4_7 Fer4_10 Fer4_9 Fer4_4 Fer4_16 Fer4_15 Fer4_8 Fer4_22 Fer4_17 Fer4_3 Fer4_13 DUF5651 Motif Other DBs NCBI-ProteinID:  UBE41362 LinkDB All DBs Position complement(84614..84841) Genome browser AA seq 75 aa AA seqDB search MAKIKGAIVVDTERCKGCNLCVVACPLNVIALTKEVNVKGYNYAHQILEDTCNGCSSCAT VCPDGCISVYKVKVE NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggcaaaaatcaaaggagcaatcgtagtagacaccgagcgttgcaaaggctgcaacctg tgtgttgtggcttgtccgctcaatgtaatagccctcaccaaagaggtgaacgtgaaaggg tataactatgcccaccagatattggaagatacctgtaacggatgcagttcatgcgcaact gtatgtccggacggatgtatctcggtttataaagtaaaagttgaataa

DBGET integrated database retrieval system