Bacillus stercoris: QI003_19340 Help Entry QI003_19340       CDS       T09305                                  Symbol mbtH Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism bstr  Bacillus stercoris Pathway bstr00261   Monobactam biosynthesis bstr01100   Metabolic pathways bstr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bstr00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     QI003_19340 (mbtH)  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bstr01008]     QI003_19340 (mbtH) Polyketide biosynthesis proteins [BR:bstr01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     QI003_19340 (mbtH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  WGV94621 LinkDB All DBs Position complement(3834121..3834330) Genome browser AA seq 69 aa AA seqDB search MANPFENADGTYLVLINEEGQYSLWPGFIDVPSGWTVVHEQKGREACLDYIQSHWRDMRP NSLKTVENV NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggcaaatccttttgaaaatgcggatggcacctatttggtgctgatcaatgaagaaggc caatattccctatggcccggttttatagatgtgccgagcggctggacagtcgttcatgaa caaaaagggcgtgaagcctgtttggactatatccaatcacattggagagacatgaggcca aacagcctaaagactgttgaaaatgtgtaa

DBGET integrated database retrieval system