Bacillus subtilis subsp. subtilis JH642: BSUA_03413 Help Entry BSUA_03413        CDS       T03443                                  Symbol ybdZ Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism bsul  Bacillus subtilis subsp. subtilis JH642 Pathway bsul00261   Monobactam biosynthesis bsul01100   Metabolic pathways bsul01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bsul00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BSUA_03413 (ybdZ)  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bsul01008]     BSUA_03413 (ybdZ) Polyketide biosynthesis proteins [BR:bsul01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BSUA_03413 (ybdZ) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AIC41663 LinkDB All DBs Position complement(3253061..3253270) Genome browser AA seq 69 aa AA seqDB search MANPFENADGTYLVLVNEEGQYSLWPGFIDVPSGWTVVHEQKGREACLDYIQSHWSDMRP NSLKTVENV NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggcaaatccttttgaaaatgcggatggcacatatttggtgctggtcaatgaagaaggc caatattccctatggccgggttttatagatgtgccgagcggctggacagtcgttcatgag caaaaagggcgtgaagcttgtttggactatatccaatcgcattggagcgatatgaggcca aacagcctaaagactgttgaaaatgtgtaa

DBGET integrated database retrieval system