Brucella suis bv. 2 PT09172: BSPT2_I0672 Help Entry BSPT2_I0672       CDS       T03504                                  Name (GenBank) Dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism bsuv  Brucella suis bv. 2 PT09172 Pathway bsuv00790   Folate biosynthesis bsuv01100   Metabolic pathways bsuv01240   Biosynthesis of cofactors Module bsuv_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:bsuv00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     BSPT2_I0672 Enzymes [BR:bsuv01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      BSPT2_I0672  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      BSPT2_I0672  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      BSPT2_I0672 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AIB24141 LinkDB All DBs Position I:complement(666434..666793) Genome browser AA seq 119 aa AA seqDB search MYTIRIMNCAFFAHHGVFDEEHKLGQRFYVDAVLDVDEGNSLESDNIDGTVHYGIAFSVI EGIIMGRQRYLIETLALDVAKALVARFPQIKRAEITVRKPNAPVSGVLDYVEVTVVYPQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt gtgtacacgatccgcatcatgaactgtgccttttttgcgcatcacggtgtcttcgatgaa gaacacaagctcggacaacgattctatgtcgatgccgttctggatgttgatgagggcaac tcgctggaaagcgacaatattgacggaacagttcattacggaattgccttctccgtcatt gaaggcatcatcatgggccgccagcgttatctgatcgaaaccctcgcgcttgatgtcgcc aaggcgctcgtcgcacggtttcctcagataaagcgggctgagatcacggtccgcaagccg aatgccccggtttcgggcgtcctcgattatgtggaagtaaccgtggtttacccccagtga

DBGET integrated database retrieval system