Brucella suis ZW043: IY71_05115 Help Entry IY71_05115        CDS       T03426                                  Name (GenBank) dienelactone hydrolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism bsw  Brucella suis ZW043 Pathway bsw00790   Folate biosynthesis bsw01100   Metabolic pathways bsw01240   Biosynthesis of cofactors Module bsw_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:bsw00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     IY71_05115 Enzymes [BR:bsw01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      IY71_05115  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      IY71_05115  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      IY71_05115 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AIN84267 LinkDB All DBs Position 1:1012461..1012820 Genome browser AA seq 119 aa AA seqDB search MYTIRIMNCAFFAHHGVFDEEHKLGQRFYVDAVLDVDEGNSLESDNIDGTVHYGIAFSVI EGIIMGRQRYLIETLALDVAKALVARFPQIKRAEITVRKPNAPVSGVLDYVEVTVVYPQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt gtgtacacgatccgcatcatgaactgtgccttttttgcgcatcacggtgtcttcgatgaa gaacacaagctcggacaacgattctatgtcgatgccgttctggatgttgatgagggcaac tcgctggaaagcgacaatattgacggaacagttcattacggaattgccttctccgtcatt gaaggcatcatcatgggccgccagcgttatctgatcgaaaccctcgcgcttgatgtcgcc aaggcgctcgtcgcacggtttcctcagataaagcgggctgagatcacggtccgcaagccg aatgccccggtttcgggcgtcctcgattatgtggaagtaaccgtggtttacccccagtga

DBGET integrated database retrieval system