Budorcas taxicolor (takin): 8250968 Help Entry 8250968           CDS       T08909                                  Symbol ND4L Name (RefSeq) NADH dehydrogenase subunit 4L   KO K03882   NADH-ubiquinone oxidoreductase chain 4L [EC:7.1.1.2] Organism btax  Budorcas taxicolor (takin) Pathway btax00190   Oxidative phosphorylation btax01100   Metabolic pathways btax04714   Thermogenesis btax04723   Retrograde endocannabinoid signaling btax05010   Alzheimer disease btax05012   Parkinson disease btax05014   Amyotrophic lateral sclerosis btax05016   Huntington disease btax05020   Prion disease btax05022   Pathways of neurodegeneration - multiple diseases btax05208   Chemical carcinogenesis - reactive oxygen species btax05415   Diabetic cardiomyopathy Module btax_M00142   NADH:ubiquinone oxidoreductase, mitochondria Brite KEGG Orthology (KO) [BR:btax00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     8250968 (ND4L)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     8250968 (ND4L)   09159 Environmental adaptation    04714 Thermogenesis     8250968 (ND4L)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     8250968 (ND4L)   09164 Neurodegenerative disease    05010 Alzheimer disease     8250968 (ND4L)    05012 Parkinson disease     8250968 (ND4L)    05014 Amyotrophic lateral sclerosis     8250968 (ND4L)    05016 Huntington disease     8250968 (ND4L)    05020 Prion disease     8250968 (ND4L)    05022 Pathways of neurodegeneration - multiple diseases     8250968 (ND4L)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     8250968 (ND4L)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:btax03029]     8250968 (ND4L) Enzymes [BR:btax01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      8250968 (ND4L) Mitochondrial biogenesis [BR:btax03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     8250968 (ND4L) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Oxidored_q2 Motif Other DBs NCBI-GeneID:  8250968 NCBI-ProteinID:  YP_003097159 UniProt:  C3TVE7 LinkDB All DBs Position MT:9881..10177 Genome browser AA seq 98 aa AA seqDB search MSLVYMNIMMAFMVSLTGLLMYRSHLMSSLLCLEGMMLSLFVMATLMILNSHFTLASMMP IILLVFAACEAALGLSLLVMVSNTYGTDYVQNLNLLQC NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgtccctcgtatacataaatattataatagcattcatggtatctctcacgggattacta atgtatcgatctcacctaatatcctccctcctatgcctggaaggaataatattgtcctta ttcgttatagctaccctaataatcctaaactcacacttcactttagccagtataataccc attattctactagttttcgcagcctgcgaagcagcactaggcctatccttgctagtaatg gtgtcaaacacatacggcaccgactacgtacaaaaccttaatctgctacaatgctaa

DBGET integrated database retrieval system