Burkholderia thailandensis MSMB121: BTI_2068 Help Entry BTI_2068          CDS       T02644                                  Name (GenBank) mbtH-like family protein   KO K05375   MbtH protein Organism btd  Burkholderia thailandensis MSMB121 Pathway btd00261   Monobactam biosynthesis btd01100   Metabolic pathways btd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:btd00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BTI_2068  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:btd01008]     BTI_2068 Polyketide biosynthesis proteins [BR:btd01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BTI_2068 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH UL2 Motif Other DBs NCBI-ProteinID:  AGK47908 LinkDB All DBs Position 1:complement(2257358..2257600) Genome browser AA seq 80 aa AA seqDB search MTQAQQPASAPAEADDVVYAVVVNDEEQYSIWPTFRALPAGWREAGVRGPKADCLAHIEA VWTDMRPASLRRHLDAANAS NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgacgcaagcccagcaacccgcgagcgcgcccgccgaggccgacgacgtcgtctacgcg gtcgtcgtcaacgacgaagagcagtactcgatctggccgacgttccgcgcgctgccggcc ggctggcgcgaagccggcgtgcgcggcccgaaggccgactgcctcgcgcacatcgaggcc gtgtggaccgacatgcgccccgcgagcctgcgccgccatctggacgcggcgaacgcgtcg tga

DBGET integrated database retrieval system