Burkholderia thailandensis MSMB121: BTI_5318 Help Entry BTI_5318          CDS       T02644                                  Symbol mbtH Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism btd  Burkholderia thailandensis MSMB121 Pathway btd00261   Monobactam biosynthesis btd01100   Metabolic pathways btd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:btd00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BTI_5318 (mbtH)  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:btd01008]     BTI_5318 (mbtH) Polyketide biosynthesis proteins [BR:btd01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BTI_5318 (mbtH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AGK51564 LinkDB All DBs Position 2:2133566..2133787 Genome browser AA seq 73 aa AA seqDB search MSWDHEDTEFNVVVNHEEQYSIWPVYKEVPAGWKTVGVSGKKAVCLDYIEKTWIDMRPLS LRRALEENARESK NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgagttgggatcatgaagataccgaatttaacgtcgtcgtcaatcatgaagagcagtat tcgatctggccggtttacaaggaagtgccggccggctggaaaacagtgggcgtgagtggc aagaaagcggtgtgtctcgattacatagaaaagacgtggatagacatgcgtccgttgagc ctgaggcgcgcgcttgaggaaaacgcgcgcgaatcgaagtga

DBGET integrated database retrieval system