Bacillus tequilensis: G4P54_16290 Help Entry G4P54_16290       CDS       T07089                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism bteq  Bacillus tequilensis Pathway bteq00261   Monobactam biosynthesis bteq01100   Metabolic pathways bteq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bteq00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     G4P54_16290  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bteq01008]     G4P54_16290 Polyketide biosynthesis proteins [BR:bteq01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     G4P54_16290 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QIW81229 UniProt:  A0A6H0WMQ4 LinkDB All DBs Position complement(3075603..3075812) Genome browser AA seq 69 aa AA seqDB search MANPFEKADGTYLVLINDEGQYSLWPAFIDVPSGWTVVHEQKGREACLDYIQSHWSDMRP NSLKPVGNV NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggcaaatccttttgaaaaagcggatggcacatatttggtgctgatcaatgatgagggc cagtattccctatggcccgcttttatagatgtgccgagcggctggacagtcgttcatgaa caaaaagggcgtgaagcttgtctggactatatccaatcgcattggagcgatatgagacca aacagcctaaagcctgttggaaatgtataa

DBGET integrated database retrieval system