Burkholderia thailandensis 2002721643: BG87_2327 Help Entry BG87_2327         CDS       T03882                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism bthl  Burkholderia thailandensis 2002721643 Pathway bthl00261   Monobactam biosynthesis bthl01100   Metabolic pathways bthl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bthl00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BG87_2327  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bthl01008]     BG87_2327 Polyketide biosynthesis proteins [BR:bthl01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BG87_2327 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AJX98590 LinkDB All DBs Position I:complement(2631918..2632166) Genome browser AA seq 82 aa AA seqDB search MTQAQQSASAPADANADDVVYAVVVNDEEQYSIWPTFRAVPAGWREVGVRGPKADCLAHI EAVWTDMRPASLRRHLDGANAS NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgacgcaagcccagcaatccgcgagcgcgcccgccgacgccaacgccgacgacgtcgtc tacgcggtcgtcgtcaacgacgaagagcagtactcgatctggccgacgttccgcgcggtg ccggccggctggcgcgaagtcggcgtgcgcggcccgaaggccgattgcctcgcgcacatc gaggccgtgtggaccgacatgcgtcccgcgagcctgcgccgtcatctggatggggcgaac gcgtcgtga

DBGET integrated database retrieval system