Bacillus thuringiensis HD-789: BTF1_09050 Help Entry BTF1_09050        CDS       T02411                                  Name (GenBank) mbtH-like protein   KO K05375   MbtH protein Organism btn  Bacillus thuringiensis HD-789 Pathway btn00261   Monobactam biosynthesis btn01100   Metabolic pathways btn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:btn00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BTF1_09050  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:btn01008]     BTF1_09050 Polyketide biosynthesis proteins [BR:btn01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BTF1_09050 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AFQ26019 UniProt:  A0A9W3JLV5 LinkDB All DBs Position 1764639..1764863 Genome browser AA seq 74 aa AA seqDB search MTNPFENDNYTYKVLINEEGQYSLWPAFLDVPIGWNVVYEEASRQSCLEYVEYNWKDLNP KSNQVREKTLAGKR NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgacgaatccatttgaaaatgataattacacatataaagtattaataaatgaggagggc cagtattctctctggcctgcttttctcgatgtacctattggctggaatgtcgtatatgaa gaagctagtaggcagagctgcttagaatatgttgaatataactggaaagatttgaatccg aaaagtaatcaagttcgcgaaaaaacattagcaggaaaacgataa

DBGET integrated database retrieval system