Bacillus thuringiensis HD-789: BTF1_26390 Help Entry BTF1_26390        CDS       T02411                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism btn  Bacillus thuringiensis HD-789 Pathway btn00790   Folate biosynthesis btn01100   Metabolic pathways btn01240   Biosynthesis of cofactors Module btn_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:btn00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     BTF1_26390 Enzymes [BR:btn01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      BTF1_26390  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      BTF1_26390  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      BTF1_26390 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Costars Motif Other DBs NCBI-ProteinID:  AFQ29440 UniProt:  A0A9W3P6G1 LinkDB All DBs Position 5115287..5115649 Genome browser AA seq 120 aa AA seqDB search MDKIYIHDMEFYGYHGVFPEENKLGQRFKVDLTVELDLKRAGESDELEHSVNYGELFELC RKVVEDRKYKLVESIAENIAADILKQYESISRCTIKVIKPDPPIPGHYRAVAVEITRERP NT seq 363 nt NT seq  +upstreamnt  +downstreamnt ttggataaaatttatatccatgatatggagttttacggttatcatggtgtgttcccggag gaaaataaattaggtcagagatttaaagttgacttaacggtggagttggatttaaagcgt gcaggggaaagtgatgaattagagcattcggtcaattatggagagcttttcgaattatgt agaaaagttgttgaagatagaaagtataagcttgtggagagtatcgctgaaaatattgct gcagatatattaaaacaatatgaaagtatttcacgatgtacaattaaggtaattaagccg gatccaccgataccaggtcattatcgtgctgtagcagtagaaattacgagagaacgtcca tga

DBGET integrated database retrieval system