Kyrpidia tusciae: Btus_0104 Help Entry Btus_0104         CDS       T01220                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism bts  Kyrpidia tusciae Pathway bts00790   Folate biosynthesis bts01100   Metabolic pathways bts01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:bts00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     Btus_0104 Enzymes [BR:bts01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      Btus_0104  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      Btus_0104  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      Btus_0104 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  ADG04882 UniProt:  D5WRM1 LinkDB All DBs Position 100311..100676 Genome browser AA seq 121 aa AA seqDB search MDAISLLGMEFYAYHGVFPEEQVLGQRFIADVHLHFSTRAAGQSDDLRDTLDYAEVYRVI RETVEGKKCRLLETVAERIAGALLMRWPVEGVRVKLVKPSPPFPGTMQGVAVEIERFRND S NT seq 366 nt NT seq  +upstreamnt  +downstreamnt gtggacgcaatcagcctgctcgggatggaattttacgcttaccacggcgtgttccccgag gaacaggttctggggcagagatttatcgcagacgtacacctacatttttctacgcgggct gcgggacagtctgacgatcttcgtgatacactggattatgcagaggtttaccgggtgatc cgggaaacggtggaagggaaaaaatgccgcttgttagagacggtcgccgagcgaatcgcc ggcgccctgttgatgcgttggccggtggaaggcgtacgggtaaaactcgtgaaaccatct cctccttttcccggcacgatgcagggggtggcggtggagattgaacggttccgaaacgat tcatga

DBGET integrated database retrieval system