Bacillus thuringiensis HD1011: BF38_3558 Help Entry BF38_3558         CDS       T03675                                  Symbol mbtH Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism btw  Bacillus thuringiensis HD1011 Pathway btw00261   Monobactam biosynthesis btw01100   Metabolic pathways btw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:btw00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BF38_3558 (mbtH)  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:btw01008]     BF38_3558 (mbtH) Polyketide biosynthesis proteins [BR:btw01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BF38_3558 (mbtH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AJG75784 LinkDB All DBs Position 3421445..3421669 Genome browser AA seq 74 aa AA seqDB search MTNPFENDNYTYKVLKNEEGQYSLWPAFLDVPIGWNVVHKEASRNDCLQYVENNWEDLNP KSNQVGKKILVGKR NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgacgaatccgtttgaaaatgataattacacatataaagtattaaaaaatgaggagggc cagtattctctctggcctgcctttcttgatgtacctattggttggaacgtcgtacataaa gaggctagtaggaatgattgtttacaatatgttgaaaataactgggaagatttgaatcca aaaagtaatcaagttggcaaaaaaatattagtaggaaaacgataa

DBGET integrated database retrieval system