Bacillus toyonensis: Btoyo_4935 Help Entry Btoyo_4935        CDS       T02901                                  Name (GenBank) Polymyxin synthetase PmxB   KO K05375   MbtH protein Organism bty  Bacillus toyonensis Pathway bty00261   Monobactam biosynthesis bty01100   Metabolic pathways bty01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bty00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Btoyo_4935  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bty01008]     Btoyo_4935 Polyketide biosynthesis proteins [BR:bty01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Btoyo_4935 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AHA10803 LinkDB All DBs Position 4875698..4875922 Genome browser AA seq 74 aa AA seqDB search MTNPFENDNYTYKVLMNEEGQYSLWPAFLDVPIGWNVVHEEASRQVCLECVEVNWNDLEP KKNQISEKILVGKQ NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgacgaatccatttgaaaatgataattacacatataaagtattaatgaatgaggagggc cagtattctctctggcctgcctttctcgatgtaccaattggatggaatgtcgtacatgaa gaagctagcagacaagtttgcttagaatgcgttgaagtaaactggaatgatttagagcca aaaaaaaatcaaattagcgaaaaaatattagtaggaaaacaataa

DBGET integrated database retrieval system