Burkholderia ubonensis: BW23_95 Help Entry BW23_95           CDS       T03794                                  Name (GenBank) mbtH-like family protein   KO K05375   MbtH protein Organism bub  Burkholderia ubonensis Pathway bub00261   Monobactam biosynthesis bub01100   Metabolic pathways bub01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bub00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BW23_95  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bub01008]     BW23_95 Polyketide biosynthesis proteins [BR:bub01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BW23_95 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AJX15648 LinkDB All DBs Position I:complement(114193..114435) Genome browser AA seq 80 aa AA seqDB search MTQATTPSADTDDLVYTVVINDEEQYSIWPTFRAVPAGWREVGVRGPKADCLAHIETVWT DMRPASLRRAMDGETARRAS NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgacgcaagccacgacgccttccgccgacaccgacgacctcgtctacacggtcgtcatc aacgacgaagaacagtattcgatctggccgacgttccgcgccgtgccggccggctggcgc gaagtgggcgtgcgcggcccgaaggccgactgtctcgcgcacatcgagaccgtctggacc gacatgcggcccgcgagcctgcgccgcgcgatggacggcgaaaccgcgcggcgcgcgtcg tga

DBGET integrated database retrieval system