Burkholderia sp. RPE67: BRPE67_CCDS02610 Help Entry BRPE67_CCDS02610  CDS       T03604                                  Symbol mbtH Name (GenBank) MbtH domain protein   KO K05375   MbtH protein Organism bue  Burkholderia sp. RPE67 Pathway bue00261   Monobactam biosynthesis bue01100   Metabolic pathways bue01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bue00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BRPE67_CCDS02610 (mbtH)  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bue01008]     BRPE67_CCDS02610 (mbtH) Polyketide biosynthesis proteins [BR:bue01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BRPE67_CCDS02610 (mbtH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  BAO89863 LinkDB All DBs Position 3:complement(297399..297581) Genome browser AA seq 60 aa AA seqDB search MDNPFDDEQGTFCVLINAMRQRSLWPAHLDVPNGWKVEHPSSSRRQCLDYIETHWSDPRS NT seq 183 nt NT seq  +upstreamnt  +downstreamnt gtggacaacccattcgacgacgaacaaggcacgttctgtgtcttgatcaatgcaatgcgg cagcgctcgctatggcccgctcatctcgacgttcccaacggctggaaagtggagcatcca agtagttcgcgcaggcaatgcctggactacatcgaaacgcactggagcgatccgcggtcc tga

DBGET integrated database retrieval system