Burkholderia lata: Bcep18194_A4779 Help Entry Bcep18194_A4779   CDS       T00286                                  Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism bur  Burkholderia lata Pathway bur00261   Monobactam biosynthesis bur01100   Metabolic pathways bur01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bur00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Bcep18194_A4779  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bur01008]     Bcep18194_A4779 Polyketide biosynthesis proteins [BR:bur01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Bcep18194_A4779 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ABB08374 UniProt:  Q39GP2 LinkDB All DBs Position 1:1778554..1778796 Genome browser AA seq 80 aa AA seqDB search MTQATTPSADTDDLVYTVVINDEEQYSIWPTFRPVPAGWREIGVSGPKADCLAHIETVWT DMRPASLRRAMDGERASRAS NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgacgcaagccacgacgccttccgccgacaccgacgacctcgtctatacggtcgtcatc aacgacgaagaacagtattcgatctggccgacgttccggcccgtgccggccggctggcgc gagatcggcgtgagcggcccgaaagccgactgtctcgcgcacatcgagaccgtctggacc gacatgcgccccgcaagcctgcgccgcgcgatggacggcgagcgcgcatcgcgcgcgtcg tga

DBGET integrated database retrieval system