Burkholderia sp. JP2-270: DM992_13025 Help Entry DM992_13025       CDS       T07766                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism burk  Burkholderia sp. JP2-270 Pathway burk00261   Monobactam biosynthesis burk01100   Metabolic pathways burk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:burk00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     DM992_13025  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:burk01008]     DM992_13025 Polyketide biosynthesis proteins [BR:burk01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     DM992_13025 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AWV00347 UniProt:  A0A2U9SNK3 LinkDB All DBs Position 1:complement(2766050..2766292) Genome browser AA seq 80 aa AA seqDB search MTQATTPSADTDDLVYTVVINDEEQYSIWPTFRPVPAGWREVGVRGPKADCLAHIETVWT DMRPASLRRAMDGERATRAS NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgacgcaagccacgacgccttccgccgacaccgacgatctcgtctatacggtcgtcatc aacgacgaagaacagtattcgatctggccgacgttccggcccgtgccggccggctggcgc gaggtcggcgtgcgcggcccgaaggccgactgtctcgcgcacatcgaaaccgtctggacc gacatgcgccccgcgagcctgcgccgtgcaatggacggcgagcgcgcgacgcgcgcctcg tga

DBGET integrated database retrieval system