Burkholderia pseudomallei TSV202: X994_5864 Help Entry X994_5864         CDS       T03428                                  Name (GenBank) mbtH-like family protein   KO K05375   MbtH protein Organism but  Burkholderia pseudomallei TSV202 Pathway but00261   Monobactam biosynthesis but01100   Metabolic pathways but01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:but00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     X994_5864  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:but01008]     X994_5864 Polyketide biosynthesis proteins [BR:but01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     X994_5864 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AIV75144 LinkDB All DBs Position 2:2689619..2689825 Genome browser AA seq 68 aa AA seqDB search MTHLLDDPDGSFQVLVNEEGQHSLWPAELPAPAGWRRTFGEAGRQACLDHIEAEWTDLRP RSVAARCA NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgactcatttgctcgacgatcccgacggctcgtttcaggtgctggtgaacgaagaaggg cagcattcgctgtggccggccgagctgcccgcgcccgcgggctggcggcgcacgttcggc gaggccggccggcaggcctgcctcgatcacatcgaagccgagtggaccgatctgcgcccg cgcagcgtcgccgcccgatgcgcgtga

DBGET integrated database retrieval system