Burkholderia pseudomallei TSV202: X994_956 Help Entry X994_956          CDS       T03428                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism but  Burkholderia pseudomallei TSV202 Pathway but00261   Monobactam biosynthesis but01100   Metabolic pathways but01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:but00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     X994_956  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:but01008]     X994_956 Polyketide biosynthesis proteins [BR:but01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     X994_956 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AIV80045 LinkDB All DBs Position 1:complement(1120628..1120870) Genome browser AA seq 80 aa AA seqDB search MTQAQQPASAPADADDVVYAVVVNDEEQYSIWPTFRAVPAGWREAGVRGPKAECLAHIEA VWTDMRPASLRRHLDAARAS NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgacgcaagcccagcaacccgcgagcgcgcccgccgacgccgacgacgtcgtctacgcg gtcgtcgtcaacgatgaagaacagtactcgatctggccgacgttccgcgcggtgccggcc ggctggcgcgaggccggcgtgcgcggcccgaaggccgagtgcctcgcgcacatcgaggcc gtgtggaccgacatgcgccccgcgagcctgcgccgccatctggacgcggcgcgcgcgtcg tga

DBGET integrated database retrieval system