Bosea vestrisii: QO058_11995 Help Entry QO058_11995       CDS       T09164                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism bves  Bosea vestrisii Pathway bves00790   Folate biosynthesis bves01100   Metabolic pathways bves01240   Biosynthesis of cofactors Module bves_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:bves00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     QO058_11995 (folB) Enzymes [BR:bves01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      QO058_11995 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      QO058_11995 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      QO058_11995 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  WID98897 LinkDB All DBs Position 2411867..2412241 Genome browser AA seq 124 aa AA seqDB search MSATGQIFIEALDLYAYHGHFAEEGRLGQRFSMDLVLDCDLRASSLSDSLADTVDYGEVV GLVTRTFSGKRFKLLEAAARALAEAILAEYPAVTKVAVTLRKPAPPIPGRMESVGIKLDF TRER NT seq 375 nt NT seq  +upstreamnt  +downstreamnt atgagcgcgacggggcagatcttcatcgaggcgctcgacctctacgcctatcacgggcat ttcgccgaagagggccggctcggccagcgcttctcgatggacctcgtcctcgactgcgac ctgcgcgcttcctcgctcagcgacagcctcgccgacaccgtcgactatggcgaggtcgtc ggcctggtcacacggaccttctccggcaagcgcttcaagctgctggaagcggccgcgcgg gcgctggccgaggcgatcctggcggaatatccggcggtgaccaaggtcgcggtcactttg cgaaagcccgctccgccgattccaggccggatggaatcggtcggcatcaagctggatttc acgcgtgagcgttga

DBGET integrated database retrieval system