Burkholderia vietnamiensis G4: Bcep1808_1578 Help Entry Bcep1808_1578     CDS       T00493                                  Name (GenBank) MbtH domain protein   KO K05375   MbtH protein Organism bvi  Burkholderia vietnamiensis G4 Pathway bvi00261   Monobactam biosynthesis bvi01100   Metabolic pathways bvi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bvi00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Bcep1808_1578  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bvi01008]     Bcep1808_1578 Polyketide biosynthesis proteins [BR:bvi01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Bcep1808_1578 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ABO54585 UniProt:  A4JE82 LinkDB All DBs Position 1:1702978..1703220 Genome browser AA seq 80 aa AA seqDB search MTQATTPSADTDDLVYTVVINDEEQYSIWPTFRAVPAGWREVGVRGPKADCLAHIDAVWT DMRPASLRRAMDGEPASRAS NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgacgcaagccacgacgccttccgcggacaccgacgacctcgtctacacggtcgtcatc aacgacgaagaacagtattcgatctggccgacgttccgggcggtgccggccggctggcgc gaggtcggcgtgcgcggcccgaaggccgactgcctcgcgcacatcgacgccgtgtggacc gacatgcgcccggcgagcctgcgccgcgcgatggacggcgagcccgcttcccgcgcgtcg tga

DBGET integrated database retrieval system