Blastochloris viridis: BVIR_3120 Help Entry BVIR_3120         CDS       T04109                                  Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism bvr  Blastochloris viridis Pathway bvr00261   Monobactam biosynthesis bvr01100   Metabolic pathways bvr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bvr00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BVIR_3120  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bvr01008]     BVIR_3120 Polyketide biosynthesis proteins [BR:bvr01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BVIR_3120 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ALK10879 UniProt:  A0A0H5BPE1 LinkDB All DBs Position 3496025..3496231 Genome browser AA seq 68 aa AA seqDB search MMDDQHVNPFDDERHLFLALVNAAGQYSLWPAFREAPAGWRVVHGPDQRAACLAHIERVW LDLMPAAV NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgatggacgaccagcacgtcaaccccttcgacgacgagcgccacctctttctggcgctg gtcaacgccgccggacagtacagcctgtggccagccttccgcgaggcgcccgccggctgg cgcgtggtgcacggcccggaccagcgcgcggcctgcctcgcgcacatcgagcgcgtctgg ctcgacctcatgcctgccgccgtttga

DBGET integrated database retrieval system