Paraburkholderia xenovorans LB400: DR64_5851 Help Entry DR64_5851         CDS       T03290                                  Name (GenBank) mbtH-like family protein   KO K05375   MbtH protein Organism bxb  Paraburkholderia xenovorans LB400 Pathway bxb00261   Monobactam biosynthesis bxb01100   Metabolic pathways bxb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bxb00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     DR64_5851  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bxb01008]     DR64_5851 Polyketide biosynthesis proteins [BR:bxb01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     DR64_5851 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AIP37219 LinkDB All DBs Position 2:1589590..1589829 Genome browser AA seq 79 aa AA seqDB search MTQAQQSSSTAAGEADDLAYTVVINDEEQYSIWPSFRDVPAGWREVGVRGPKAECLAHIE TVWTDMRPASLRRHMDGAA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgacgcaagcacagcagagttccagcacggcagccggcgaggcggacgatctcgcctac acggtcgtcatcaacgacgaagagcagtactcgatctggccgtccttccgcgacgtgccg gccggctggcgcgaagtgggcgtgcgcggcccgaaggccgaatgtctcgcgcacatcgag actgtctggaccgatatgcgcccggccagcttgcgccggcatatggacggcgcggcctga

DBGET integrated database retrieval system