Bacillus velezensis YAU B9601-Y2: BANAU_3089 Help Entry BANAU_3089        CDS       T02050                                  Symbol ybdZ Name (GenBank) Protein mbtH   KO K05375   MbtH protein Organism bya  Bacillus velezensis YAU B9601-Y2 Pathway bya00261   Monobactam biosynthesis bya01100   Metabolic pathways bya01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bya00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BANAU_3089 (ybdZ)  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bya01008]     BANAU_3089 (ybdZ) Polyketide biosynthesis proteins [BR:bya01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BANAU_3089 (ybdZ) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  CCG51110 UniProt:  I2C9N4 LinkDB All DBs Position complement(3302577..3302792) Genome browser AA seq 71 aa AA seqDB search MTNPFEREDGSYHVLVNAEGQYSLWPAYLDVPDGWETRLTNETRPVCLEYIETNWRDMRP ESLKQAEAAKM NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgacaaatccatttgaacgggaagacggctcataccatgtgctcgtcaatgctgaaggc cagtactcactgtggccggcctatctggatgtaccggacggctgggaaacccgcctgacg aatgaaacccgccccgtttgtctcgaatatattgaaacaaactggcgtgatatgaggccg gaaagcctgaaacaggccgaagccgctaaaatgtaa

DBGET integrated database retrieval system