Burkholderia sp. YI23: BYI23_C008600 Help Entry BYI23_C008600     CDS       T01711                                  Symbol mbtH Name (GenBank) MbtH domain protein   KO K05375   MbtH protein Organism byi  Burkholderia sp. YI23 Pathway byi00261   Monobactam biosynthesis byi01100   Metabolic pathways byi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:byi00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BYI23_C008600 (mbtH)  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:byi01008]     BYI23_C008600 (mbtH) Polyketide biosynthesis proteins [BR:byi01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BYI23_C008600 (mbtH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AET93006 LinkDB All DBs Position 3:993154..993336 Genome browser AA seq 60 aa AA seqDB search MDNPFDDEQGTFCVLINAMRQRSLWPAHLDVPNGWKVEHPSSSRRQCLDYIETHWSDPRS NT seq 183 nt NT seq  +upstreamnt  +downstreamnt gtggacaacccattcgacgacgaacaaggcacgttctgtgtcttgatcaatgcaatgcgg cagcgctcgctatggcccgctcatctcgacgttcccaacggctggaaagtggagcatcca agtagttcgcgcaggcaatgcctggactacatcgaaacgcactggagcgatccgcggtcc tga

DBGET integrated database retrieval system