Blautia pseudococcoides: A4V09_12830 Help Entry A4V09_12830       CDS       T04458                                  Name (GenBank) oxidoreductase   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism byl  Blautia pseudococcoides Pathway byl00020   Citrate cycle (TCA cycle) byl00720   Other carbon fixation pathways byl01100   Metabolic pathways byl01110   Biosynthesis of secondary metabolites byl01120   Microbial metabolism in diverse environments byl01200   Carbon metabolism byl01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:byl00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     A4V09_12830   09102 Energy metabolism    00720 Other carbon fixation pathways     A4V09_12830 Enzymes [BR:byl01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      A4V09_12830 SSDB OrthologParalogGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_6 Fer4_10 Fer4_2 Fer4_9 Fer4_21 Fer4_16 LdpA_Fe-S-bd Fer4_4 Fer4_17 Fer4_8 Fer4_22 Fer4_3 Fer4_15 Fer4_13 Fer4_18 zf-C2H2_11 Motif Other DBs NCBI-ProteinID:  ANU76577 UniProt:  A0A1C7IA87 LinkDB All DBs Position complement(2733582..2733785) Genome browser AA seq 67 aa AA seqDB search MGKEKVYTNPVRCKGCGYCINACPQDAIRESGHVNAKGYNTVEVDAEKCVVCGMCYRVCP DYVFEIR NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgggaaaagaaaaagtttacaccaatcccgtccgctgtaaaggctgcggttattgtatc aatgcatgtccccaggatgccatcagggaatccggccatgtaaacgccaagggatacaat acggtggaagtggatgcagaaaaatgtgtggtatgcggcatgtgttaccgcgtatgcccg gactatgtatttgaaatacgatga

DBGET integrated database retrieval system