Bipolaris zeicola: COCCADRAFT_3947 Help Entry COCCADRAFT_3947   CDS       T03110                                  Name (RefSeq) hypothetical protein   KO K03014   DNA-directed RNA polymerases I, II, and III subunit RPABC2 Organism bze  Bipolaris zeicola Pathway bze03020   RNA polymerase bze03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:bze00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     COCCADRAFT_3947   09124 Replication and repair    03420 Nucleotide excision repair     COCCADRAFT_3947  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:bze03021]     COCCADRAFT_3947    03400 DNA repair and recombination proteins [BR:bze03400]     COCCADRAFT_3947 Transcription machinery [BR:bze03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      COCCADRAFT_3947   RNA polymerase III system    RNA polymerase III      COCCADRAFT_3947   RNA polymerase I system    RNA polymerase I      COCCADRAFT_3947 DNA repair and recombination proteins [BR:bze03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       COCCADRAFT_3947 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_Rpb6 Motif Other DBs NCBI-GeneID:  19149007 NCBI-ProteinID:  XP_007710942 JGI:  3947 UniProt:  W6Y5H4 LinkDB All DBs Position Unknown AA seq 162 aa AA seqDB search MSDNGDDYDGGAGDIDEPLIEFDEEAEPDLMDDEDDHMGGGGEDPDNADPNDDNVVVSGD ASAAAAAREAAKNTVTSEKDKKVPNDKRTTTPYMTKYEKARVLGTRALQISGNAPVLIDV EGMTDPLQIAAKELQEKKIPLVVRRYLPDGFYEDWTCEELLT NT seq 489 nt NT seq  +upstreamnt  +downstreamnt atgtccgacaacggtgacgactacgatggcggtgctggagacatcgatgagcctctcatc gagttcgatgaagaagccgagcccgatctcatggacgacgaggacgaccacatgggcggc ggcggcgaggacccagacaacgccgaccccaacgacgacaatgtagtggtgtccggcgat gccagcgcggctgcagcagccagggaggcagccaaaaacactgtcacgagcgagaaagac aaaaaggtccccaacgacaagcgcacaaccacgccttacatgaccaagtacgagaaggcg cgtgtgctcggtacaagagcgctccagatcagtggaaatgccccggtattgattgacgtg gaaggtatgacggatcctctgcagattgctgccaaggaattgcaagagaagaagattccg ttggttgtacggagatatctgcctgatggtttctacgaagactggacttgtgaagaactc ttgacataa

DBGET integrated database retrieval system