Catenulispora acidiphila: Caci_5064 Help Entry Caci_5064         CDS       T00967                                  Name (GenBank) MbtH domain protein   KO K05375   MbtH protein Organism cai  Catenulispora acidiphila Pathway cai00261   Monobactam biosynthesis cai01100   Metabolic pathways cai01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cai00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Caci_5064  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:cai01008]     Caci_5064 Polyketide biosynthesis proteins [BR:cai01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Caci_5064 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ACU73924 UniProt:  C7Q4X6 LinkDB All DBs Position complement(5810749..5810952) Genome browser AA seq 67 aa AA seqDB search MNATQVVVNDEDQYSLWPAEALPPAGWRVEGFSGTREDCLAHIEAVWTDMRPRSVREASQ EAESRHG NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgaacgcgacccaggtcgtggtgaacgacgaggaccagtactcgctctggcccgccgag gcgctgccgccggccggttggcgggtcgaggggttctcgggcacgcgcgaggactgcctc gctcacatcgaagccgtctggacggacatgcgtccgcgcagcgtgcgggaggcttcgcag gaggctgagtcccgccatggctga

DBGET integrated database retrieval system