Candidatus Chlorohelix allophototropha: OZ401_001350 Help Entry OZ401_001350      CDS       T09929                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism call  Candidatus Chlorohelix allophototropha Pathway call00261   Monobactam biosynthesis call01100   Metabolic pathways call01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:call00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     OZ401_001350  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:call01008]     OZ401_001350 Polyketide biosynthesis proteins [BR:call01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     OZ401_001350 BRITE hierarchy Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  WJW65583 LinkDB All DBs Position 1:1603723..1603944 Genome browser AA seq 73 aa AA seqDB search MSWDDREDNTIYKVVMNHEEQYSIWPAYRENALGWSDVGKSGTKQECLDYIKEVWTDMRP LSLLQKMEEQTEG NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgagttgggatgaccgtgaagataacactatatataaagtagtaatgaaccatgaagag cagtattcaatttggcctgcctaccgcgaaaatgctttaggctggagcgatgttgggaaa tcgggtactaaacaggagtgccttgattatatcaaggaggtgtggacggatatgcgtccg ctttcattgcttcagaagatggaagaacaaaccgagggctga

DBGET integrated database retrieval system