Corynebacterium anserum: GP473_01385 Help Entry GP473_01385       CDS       T07289                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism cans  Corynebacterium anserum Pathway cans00790   Folate biosynthesis cans01100   Metabolic pathways cans01240   Biosynthesis of cofactors Module cans_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:cans00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     GP473_01385 (folB) Enzymes [BR:cans01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      GP473_01385 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      GP473_01385 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      GP473_01385 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  QNH95527 UniProt:  A0A7G7YM07 LinkDB All DBs Position 360119..360484 Genome browser AA seq 121 aa AA seqDB search MADRIELIGLEAYGYHGVYEHEKKAGQKFLVDMVVWTDFSAAAASDSIADTISYVDLADI AVELVKGPGNDLIETLAASIADRIVELNGVLATEITVHKPQAPIEYPFADVRVVARRSSK G NT seq 366 nt NT seq  +upstreamnt  +downstreamnt gtggcagatcgcatcgagctcattggtttggaggcctacggctatcacggggtctatgag cacgagaagaaggccggccagaagttcttggtcgatatggtcgtctggactgatttttcc gcggctgcagcctccgattccatcgcggacaccatcagctacgtagatttggctgacatc gccgttgagttggtcaaagggccgggcaacgatctgatcgaaacacttgccgcgagcatt gcagatcggattgttgagcttaatggagttctcgccactgaaatcactgtgcacaaaccc caggctcccattgagtatccgtttgccgacgtgcgcgtggtggctcgtcgctcgtcgaag gggtga

DBGET integrated database retrieval system