Capnocytophaga sp. oral taxon 902: HW278_07040 Help Entry HW278_07040       CDS       T08773                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism capo  Capnocytophaga sp. oral taxon 902 Pathway capo00790   Folate biosynthesis capo01100   Metabolic pathways capo01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:capo00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     HW278_07040 (folB) Enzymes [BR:capo01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      HW278_07040 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      HW278_07040 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      HW278_07040 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  QLF50483 UniProt:  A0A7H8YTJ7 LinkDB All DBs Position complement(1648216..1648581) Genome browser AA seq 121 aa AA seqDB search MQHIILKNIRVRANHGCLVEEGIIGSDYRVDVKVKVPLEKAIKSDRLADTVDYVHLNRIV KEEMAIRSELLEHVAGRIIDRIFKELSEVQKITLEIAKINPPINGDVASVSVKIKQKKLA N NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atgcaacatattatcttaaagaatatacgcgttcgcgccaatcacgggtgccttgttgaa gagggtattatagggagtgattaccgcgtggatgtgaaggtgaaagttcctcttgaaaaa gctattaaaagcgaccggcttgctgacacggtagactatgtacacttgaacaggattgta aaagaagagatggctatacggtcggaattattagagcacgtagcgggtcgcattatagac aggatattcaaagagctttctgaggttcagaagataacacttgaaattgcgaaaatcaat ccccctattaatggcgacgtagcctcggtgagtgtaaaaataaaacagaaaaaacttgct aattaa

DBGET integrated database retrieval system