Catellatospora sp. IY07-71: CS0771_32180 Help Entry CS0771_32180      CDS       T07191                                  Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism cati  Catellatospora sp. IY07-71 Pathway cati00261   Monobactam biosynthesis cati01100   Metabolic pathways cati01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cati00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CS0771_32180  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:cati01008]     CS0771_32180 Polyketide biosynthesis proteins [BR:cati01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CS0771_32180 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  BCJ73674 UniProt:  A0A810NNP3 LinkDB All DBs Position 3535509..3535727 Genome browser AA seq 72 aa AA seqDB search MSNPFDDDNGTFLVLVNDENQHSLWPAFADVPAGWRTVCGPAPRQDCLDHIERQWTDMRP ASLARRMAEQQA NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgagcaaccccttcgacgacgacaacggcaccttcctcgtgctggtgaacgacgagaac cagcactcgctgtggcccgcgttcgccgacgtgccggccgggtggcgcaccgtctgcggc cccgcgccgcggcaggactgcctcgaccacatcgagcggcagtggaccgacatgcgcccg gccagcctggcccggcgcatggccgagcagcaggcctga

DBGET integrated database retrieval system