Cercocebus atys (sooty mangabey): 105591123 Help Entry 105591123         CDS       T07242                                  Symbol IL1B Name (RefSeq) interleukin-1 beta   KO K04519   interleukin 1 beta Organism caty  Cercocebus atys (sooty mangabey) Pathway caty01523   Antifolate resistance caty04010   MAPK signaling pathway caty04060   Cytokine-cytokine receptor interaction caty04064   NF-kappa B signaling pathway caty04217   Necroptosis caty04380   Osteoclast differentiation caty04620   Toll-like receptor signaling pathway caty04621   NOD-like receptor signaling pathway caty04623   Cytosolic DNA-sensing pathway caty04625   C-type lectin receptor signaling pathway caty04640   Hematopoietic cell lineage caty04657   IL-17 signaling pathway caty04659   Th17 cell differentiation caty04668   TNF signaling pathway caty04750   Inflammatory mediator regulation of TRP channels caty04932   Non-alcoholic fatty liver disease caty04933   AGE-RAGE signaling pathway in diabetic complications caty04936   Alcoholic liver disease caty04940   Type I diabetes mellitus caty05010   Alzheimer disease caty05020   Prion disease caty05022   Pathways of neurodegeneration - multiple diseases caty05132   Salmonella infection caty05133   Pertussis caty05134   Legionellosis caty05135   Yersinia infection caty05140   Leishmaniasis caty05142   Chagas disease caty05143   African trypanosomiasis caty05144   Malaria caty05146   Amoebiasis caty05152   Tuberculosis caty05162   Measles caty05163   Human cytomegalovirus infection caty05164   Influenza A caty05168   Herpes simplex virus 1 infection caty05171   Coronavirus disease - COVID-19 caty05321   Inflammatory bowel disease caty05323   Rheumatoid arthritis caty05332   Graft-versus-host disease caty05417   Lipid and atherosclerosis caty05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:caty00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     105591123 (IL1B)    04064 NF-kappa B signaling pathway     105591123 (IL1B)    04668 TNF signaling pathway     105591123 (IL1B)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105591123 (IL1B)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     105591123 (IL1B)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     105591123 (IL1B)    04620 Toll-like receptor signaling pathway     105591123 (IL1B)    04621 NOD-like receptor signaling pathway     105591123 (IL1B)    04623 Cytosolic DNA-sensing pathway     105591123 (IL1B)    04625 C-type lectin receptor signaling pathway     105591123 (IL1B)    04659 Th17 cell differentiation     105591123 (IL1B)    04657 IL-17 signaling pathway     105591123 (IL1B)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     105591123 (IL1B)   09158 Development and regeneration    04380 Osteoclast differentiation     105591123 (IL1B)  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     105591123 (IL1B)    05164 Influenza A     105591123 (IL1B)    05162 Measles     105591123 (IL1B)    05168 Herpes simplex virus 1 infection     105591123 (IL1B)    05163 Human cytomegalovirus infection     105591123 (IL1B)   09171 Infectious disease: bacterial    05132 Salmonella infection     105591123 (IL1B)    05135 Yersinia infection     105591123 (IL1B)    05133 Pertussis     105591123 (IL1B)    05134 Legionellosis     105591123 (IL1B)    05152 Tuberculosis     105591123 (IL1B)   09174 Infectious disease: parasitic    05146 Amoebiasis     105591123 (IL1B)    05144 Malaria     105591123 (IL1B)    05140 Leishmaniasis     105591123 (IL1B)    05142 Chagas disease     105591123 (IL1B)    05143 African trypanosomiasis     105591123 (IL1B)   09163 Immune disease    05323 Rheumatoid arthritis     105591123 (IL1B)    05321 Inflammatory bowel disease     105591123 (IL1B)    05332 Graft-versus-host disease     105591123 (IL1B)   09164 Neurodegenerative disease    05010 Alzheimer disease     105591123 (IL1B)    05020 Prion disease     105591123 (IL1B)    05022 Pathways of neurodegeneration - multiple diseases     105591123 (IL1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105591123 (IL1B)    05418 Fluid shear stress and atherosclerosis     105591123 (IL1B)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     105591123 (IL1B)    04936 Alcoholic liver disease     105591123 (IL1B)    04932 Non-alcoholic fatty liver disease     105591123 (IL1B)    04933 AGE-RAGE signaling pathway in diabetic complications     105591123 (IL1B)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     105591123 (IL1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:caty04052]     105591123 (IL1B)    00536 Glycosaminoglycan binding proteins [BR:caty00536]     105591123 (IL1B) Cytokines and neuropeptides [BR:caty04052]  Cytokines   Interleukins    105591123 (IL1B) Glycosaminoglycan binding proteins [BR:caty00536]  Heparan sulfate / Heparin   Cytokines    105591123 (IL1B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL1 IL1_propep Motif Other DBs NCBI-GeneID:  105591123 NCBI-ProteinID:  XP_011926966 Ensembl:  ENSCATG00000032875 UniProt:  A0A2K5LYI4 LinkDB All DBs Position Unknown AA seq 268 aa AA seqDB search MAEVPELASEMMAYYSGNEDDLFFEVDGPKQMKCSFQDLDLCPLDGGIQLQISHEHYNKG FRQAVSVVVAMEKLRKMLVPCPQTFQDNDLSTLIPFIFEEEPVFLDTCSNDACVHDAPVR SLHCTLRDAQLKSLVMSGPYELKALHLQGQDVEQQVVFSMSFVQGEESNDKVPVALGLKA KNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYIST SQAENMPVFLGGTRGGQDITDFTMQFVS NT seq 807 nt NT seq  +upstreamnt  +downstreamnt atggcagaagtacctgaactcgccagtgaaatgatggcttactacagcggcaacgaggat gacttgttctttgaagtcgatggccctaaacagatgaagtgctccttccaggatctagac ctctgccctctggatggcggcatccagctacaaatctcccacgagcactacaacaagggc ttccggcaggccgtgtcggttgttgtagccatggagaagctaaggaagatgctggttccc tgcccacagaccttccaggacaatgacctgagcaccttgattcccttcatctttgaagaa gaacctgtcttcctcgacacatgcagtaacgacgcttgtgtgcatgatgcacctgtacga tcactgcactgcacactccgggatgcacagctcaaaagcttggtgatgtctggtccatat gaactgaaagctctccacctccagggacaggatgtggagcaacaagtggtgttctccatg tcctttgtacaaggagaagaaagtaatgacaaagtacctgtggccttgggcctcaaggca aagaacctgtacctgtcctgcgtgttgaaagatgataagcccacgctacagctggagagt gtagatcccaaaaattacccgaagaagaagatggaaaagcgatttgtcttcaacaagata gaaatcaataacaagctggaatttgagtctgcccaattccccaactggtacatcagcacc tctcaagcagaaaatatgcccgtcttcctgggagggaccagaggtggccaggatataact gacttcaccatgcaatttgtgtcttga

DBGET integrated database retrieval system