Campylobacter avium: CAV_0168 Help Entry CAV_0168          CDS       T05533                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism cavi  Campylobacter avium Pathway cavi00790   Folate biosynthesis cavi01100   Metabolic pathways cavi01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:cavi00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     CAV_0168 (folB) Enzymes [BR:cavi01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      CAV_0168 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      CAV_0168 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      CAV_0168 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Mad3_BUB1_II Motif Other DBs NCBI-ProteinID:  ASQ29840 UniProt:  A0A222MW38 LinkDB All DBs Position complement(165166..165495) Genome browser AA seq 109 aa AA seqDB search MQEFKLKIKDLEFETIIGILDFEREKKQRIVLNAEFLYEFSEEILDYRLLREFLLQAFDK NFDTLENALVYFQEHIPKNFKNITYFHIELSKTQIFKDCLVSVSLEYKR NT seq 330 nt NT seq  +upstreamnt  +downstreamnt atgcaagaatttaagcttaagataaaagacttagaatttgaaactataattggcatacta gactttgaaagggagaaaaaacaaaggatagttttaaatgctgaatttttgtatgaattt agcgaagaaattcttgattacaggcttttgcgtgaatttttactgcaagcttttgataaa aattttgataccttagaaaatgctcttgtatattttcaagagcatatacctaagaacttt aaaaacataacatattttcacatagaacttagcaaaacacaaatttttaaagactgcttg gtatctgtatctcttgaatataaaaggtaa

DBGET integrated database retrieval system