Coxiella burnetii CbuG_Q212: CbuG_1976 Help Entry CbuG_1976         CDS       T00787                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism cbg  Coxiella burnetii CbuG_Q212 Pathway cbg00790   Folate biosynthesis cbg01100   Metabolic pathways cbg01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:cbg00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     CbuG_1976 (folB) Enzymes [BR:cbg01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      CbuG_1976 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      CbuG_1976 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      CbuG_1976 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  ACJ19218 LinkDB All DBs Position complement(1899337..1899639) Genome browser AA seq 100 aa AA seqDB search MSHEKAEKQILSIDIVYHINAKQAALSDEILHTIDYASVRENLIHFLNDHRFNLIETLAE RCADFLLTRFKMSWLQLSITKPSIFDDADGAGIIIERTSS NT seq 303 nt NT seq  +upstreamnt  +downstreamnt ttgtcgcacgaaaaagcagaaaaacagattctttcgatcgacattgtttatcatatcaat gcaaagcaggcagcgttatcggatgaaattcttcataccattgactatgctagcgttcgc gaaaatctcatccattttctaaacgatcatcgattcaatttaattgaaacattggccgaa cgatgcgccgattttttattgacgcgctttaaaatgagttggcttcaactcagcatcact aaaccctctatttttgatgatgccgatggcgcaggcattatcattgaacggacgtcctca taa

DBGET integrated database retrieval system