Enterocloster bolteae: CGC65_22830 Help Entry CGC65_22830       CDS       T05466                                  Name (GenBank) ferredoxin family protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism cbol  Enterocloster bolteae Pathway cbol00020   Citrate cycle (TCA cycle) cbol01100   Metabolic pathways cbol01110   Biosynthesis of secondary metabolites cbol01120   Microbial metabolism in diverse environments cbol01200   Carbon metabolism cbol01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:cbol00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     CGC65_22830 Enzymes [BR:cbol01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      CGC65_22830 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_9 Fer4_7 Fer4_21 Fer4_2 Fer4_10 Fer4_4 Fer4_6 Fer4_16 Fer4_15 Fer4_13 Fer4_17 Fer4_3 Fer4_8 Motif Other DBs NCBI-ProteinID:  ASN97243 LinkDB All DBs Position complement(4944153..4944341) Genome browser AA seq 62 aa AA seqDB search MSTITINQKWCKTCGICIAFCPRHVFKMNENGYPYPARQEDCIGCRLCELRCPDFAVKVE EG NT seq 189 nt NT seq  +upstreamnt  +downstreamnt ttgagtacgattacaataaatcagaaatggtgcaagacatgtggaatctgtatagcgttc tgccccaggcatgtatttaaaatgaatgagaatgggtatccatatccggccaggcaggaa gactgtattggatgcaggctttgtgaactgcgctgtccggactttgcagtaaaggttgag gagggatga

DBGET integrated database retrieval system