Coxiella burnetii RSA 331: COXBURSA331_A0116 Help Entry COXBURSA331_A0116 CDS       T00632                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism cbs  Coxiella burnetii RSA 331 Pathway cbs00790   Folate biosynthesis cbs01100   Metabolic pathways cbs01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:cbs00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     COXBURSA331_A0116 (folB) Enzymes [BR:cbs01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      COXBURSA331_A0116 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      COXBURSA331_A0116 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      COXBURSA331_A0116 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB DUF3969 Motif Other DBs NCBI-ProteinID:  ABX77414 LinkDB All DBs Position 100731..101084 Genome browser AA seq 117 aa AA seqDB search MDKLFIRNLRVPAQVGILSHEKAEKQILSIDIVYHINAKQAALSDEILHTIDYASVRENL IHFLNDHRFNLIETLAERCADFLLTRFKMSWLQLSITKPSIFDDADGAGIIIERTSS NT seq 354 nt NT seq  +upstreamnt  +downstreamnt gtggataaactttttattcgtaacttacgcgtgcctgcacaagtcggtattttgtcgcac gaaaaagcagaaaaacagattctttcgatcgacattgtttatcatatcaatgcaaagcag gcagcgttatcggatgaaattcttcataccattgactatgctagcgttcgcgaaaatctc atccattttctaaacgatcatcgattcaatttaattgaaacattggccgaacgatgcgcc gattttttattgacgcgctttaaaatgagttggcttcaactcagcatcactaaaccctct atttttgatgatgccgatggcgcaggcattatcattgaacggacgtcctcataa

DBGET integrated database retrieval system