KEGG Orthology (KO) [BR:ccar00001]
09100 Metabolism
09104 Nucleotide metabolism
00240 Pyrimidine metabolism
109050885 (dut)
09111 Xenobiotics biodegradation and metabolism
00983 Drug metabolism - other enzymes
109050885 (dut)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03400 DNA repair and recombination proteins [BR:ccar03400]
109050885 (dut)
Enzymes [BR:ccar01000]
3. Hydrolases
3.6 Acting on acid anhydrides
3.6.1 In phosphorus-containing anhydrides
3.6.1.23 dUTP diphosphatase
109050885 (dut)
DNA repair and recombination proteins [BR:ccar03400]
Eukaryotic type
Other factors with a suspected DNA repair function
Modulation of nucleotide pools
109050885 (dut)
Prokaryotic type
109050885 (dut)
152 aa
MPCSEVTEAVSPQKRCKSDAVSGHEEVKVLRFAKLTENATTPSRGSNRAAGFDLYSAYDY
SIGPMDKALVKTDIQIAVPHGYYGRVAPRSGLAVKHFIDVGAGVVDEDYRGNLGVVLFNF
NKEPFEVKKGERIAQLICERICYPELQELQCI