Cyprinus carpio (common carp): 109074116 Help Entry 109074116         CDS       T05134                                  Name (RefSeq) ferritin, heavy subunit-like   KO K00522   ferritin heavy chain [EC:1.16.3.1] Organism ccar  Cyprinus carpio (common carp) Pathway ccar00860   Porphyrin metabolism ccar04216   Ferroptosis ccar04217   Necroptosis Brite KEGG Orthology (KO) [BR:ccar00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00860 Porphyrin metabolism     109074116  09140 Cellular Processes   09143 Cell growth and death    04216 Ferroptosis     109074116    04217 Necroptosis     109074116  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccar04147]     109074116 Enzymes [BR:ccar01000]  1. Oxidoreductases   1.16  Oxidizing metal ions    1.16.3  With oxygen as acceptor     1.16.3.1  ferroxidase      109074116 Exosome [BR:ccar04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    109074116   Exosomal proteins of bladder cancer cells    109074116 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ferritin Rubrerythrin FCH MAS20 Dynein_heavy Motif Other DBs NCBI-GeneID:  109074116 NCBI-ProteinID:  XP_018945710 LinkDB All DBs Position Unknown AA seq 122 aa AA seqDB search MSSQVRQNFHQECEAAVNRQIYLELYASYVYLSMGYYFDRDDKSLPNFAKFFREQSKEER EHAEKLMSLQNQRGGWIYLQDIKKPDRDEWGSGLEALECALALGKECKSVPTGASQGGNS TQ NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atgagttctcaggtgaggcagaacttccatcaggagtgtgaggcagccgttaacagacag atttacctggagctgtacgcctcttatgtctacctgtccatgggctactattttgacagg gatgacaagtctttgcccaactttgccaagtttttccgcgaacaatctaaggaggagcga gaacatgcggagaagctgatgagtctgcagaaccaaagaggaggatggatctacctgcag gacatcaagaagccggatcgggatgagtggggcagtggtctggaagcgctggaatgtgct ctggctctaggaaaagagtgtaaatctgtccctactggagcttcacaaggtggcaactca acacaatga

DBGET integrated database retrieval system