Cyprinus carpio (common carp): 109080092 Help Entry 109080092         CDS       T05134                                  Name (RefSeq) ferritin, middle subunit-like   KO K00522   ferritin heavy chain [EC:1.16.3.1] Organism ccar  Cyprinus carpio (common carp) Pathway ccar00860   Porphyrin metabolism ccar04216   Ferroptosis ccar04217   Necroptosis Brite KEGG Orthology (KO) [BR:ccar00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00860 Porphyrin metabolism     109080092  09140 Cellular Processes   09143 Cell growth and death    04216 Ferroptosis     109080092    04217 Necroptosis     109080092  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccar04147]     109080092 Enzymes [BR:ccar01000]  1. Oxidoreductases   1.16  Oxidizing metal ions    1.16.3  With oxygen as acceptor     1.16.3.1  ferroxidase      109080092 Exosome [BR:ccar04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    109080092   Exosomal proteins of bladder cancer cells    109080092 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ferritin Motif Other DBs NCBI-GeneID:  109080092 NCBI-ProteinID:  XP_018950728 UniProt:  A0A9Q9V9F4 LinkDB All DBs Position Unknown AA seq 108 aa AA seqDB search MELQNKRGDAIVLQDIKKPDRDMWGNGLIAMQCALQLEKNINQALLDLHKVASEKGDPHL CDFLETHYLNEQVEAIKKVGDHITNLSKMDAGNNRMAEYLFDKHTLDS NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggagctccagaacaagaggggggacgcgatcgtcctccaggacatcaagaaacctgat cgtgatatgtggggcaatggactgattgctatgcagtgcgctcttcagctggagaagaac atcaaccaggctctgctggatctgcataaggtcgcctctgagaagggagaccctcatctg tgtgacttcctggagactcactacctgaatgagcaggttgaggccatcaagaaagttggt gaccacatcaccaacctttccaagatggatgctggcaacaacaggatggcggagtacctg tttgacaagcacaccctggacagctaa

DBGET integrated database retrieval system