Caretta caretta (Loggerhead turtle): 125638722 Help Entry 125638722         CDS       T09292                                  Name (RefSeq) ferritin heavy chain-like   KO K00522   ferritin heavy chain [EC:1.16.3.1] Organism ccay  Caretta caretta (Loggerhead turtle) Pathway ccay00860   Porphyrin metabolism ccay04216   Ferroptosis ccay04217   Necroptosis Brite KEGG Orthology (KO) [BR:ccay00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00860 Porphyrin metabolism     125638722  09140 Cellular Processes   09143 Cell growth and death    04216 Ferroptosis     125638722    04217 Necroptosis     125638722  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccay04147]     125638722 Enzymes [BR:ccay01000]  1. Oxidoreductases   1.16  Oxidizing metal ions    1.16.3  With oxygen as acceptor     1.16.3.1  ferroxidase      125638722 Exosome [BR:ccay04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    125638722   Exosomal proteins of bladder cancer cells    125638722 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ferritin Motif Other DBs NCBI-GeneID:  125638722 NCBI-ProteinID:  XP_048710761 LinkDB All DBs Position 6:77805705..77815442 Genome browser AA seq 136 aa AA seqDB search MHTQKINLELYTSYVYLSMSFYFDRDDVALKNFARYFLHQSHKECEHAEKLMKLQNQRGG CIFLQDIKKPDCDDWENGLTAMECALHLEKNVNQSLLDLHKLATDKNDPHLCDFIETHYL GPIFNLWAHPPLLEIW NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atgcacactcagaagatcaacctggagctctacacctcctacgtgtacctcagcatgtct ttctattttgaccgggatgatgtggctctaaagaactttgccaggtatttcctgcaccag tcccacaaggagtgtgagcatgctgaaaaactcatgaagctgcagaaccagaggggcggt tgcatctttttgcaggacatcaagaaaccagattgtgatgattgggagaatgggttgaca gcaatggagtgtgccttgcacctggaaaagaatgtgaaccagtcactccttgatctgcac aagctggcaactgacaagaatgaccctcatttgtgcgacttcattgaaacccactacttg gggcccatatttaatctatgggcccatcctcccctactggagatttggtag

DBGET integrated database retrieval system