Caretta caretta (Loggerhead turtle): 125641850 Help Entry 125641850         CDS       T09292                                  Name (RefSeq) ferritin heavy chain-like   KO K00522   ferritin heavy chain [EC:1.16.3.1] Organism ccay  Caretta caretta (Loggerhead turtle) Pathway ccay00860   Porphyrin metabolism ccay04216   Ferroptosis ccay04217   Necroptosis Brite KEGG Orthology (KO) [BR:ccay00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00860 Porphyrin metabolism     125641850  09140 Cellular Processes   09143 Cell growth and death    04216 Ferroptosis     125641850    04217 Necroptosis     125641850  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccay04147]     125641850 Enzymes [BR:ccay01000]  1. Oxidoreductases   1.16  Oxidizing metal ions    1.16.3  With oxygen as acceptor     1.16.3.1  ferroxidase      125641850 Exosome [BR:ccay04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    125641850   Exosomal proteins of bladder cancer cells    125641850 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ferritin Rubrerythrin Motif Other DBs NCBI-GeneID:  125641850 NCBI-ProteinID:  XP_048718321 LinkDB All DBs Position 8:66184778..66185262 Genome browser AA seq 145 aa AA seqDB search MSSSPSQVGQNYNQDCKEAVNRQINLELYASYMYLSMSFYFDRDDVALKNFAKYFLHQSH EEREHAEKLMKLQNQRGGRIFLQDIKKPDRDDWENGLTAMECALHLEKNVNQSLLDLHKL ATDKNDPHLCGFIARLLTLLFSHSN NT seq 438 nt NT seq  +upstreamnt  +downstreamnt atgtcttcgtctccatcccaggttggccagaactacaaccaggactgcaaggaggccgtc aaccgccagatcaacctggagctctatgcctcctacatgtacctcagcatgtctttctat tttgaccgggatgatgtggctctaaagaactttgccaagtatttcctgcaccagtcccac gaggagcgtgaacatgctgaaaaactcatgaagctgcagaaccagaggggcggtcgcatc tttttgcaggacatcaagaaaccagatcgtgatgattgggagaatgggttgacagcaatg gagtgtgccttgcacctggaaaagaatgtgaaccagtcactccttgatctgcacaagctg gcaactgacaagaatgaccctcatttgtgtggtttcattgccaggctcctgaccctcctc ttctcacactctaattaa

DBGET integrated database retrieval system