Couchioplanes caeruleus: COUCH_31765 Help Entry COUCH_31765       CDS       T08133                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism ccaz  Couchioplanes caeruleus Pathway ccaz00261   Monobactam biosynthesis ccaz01100   Metabolic pathways ccaz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ccaz00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     COUCH_31765  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:ccaz01008]     COUCH_31765 Polyketide biosynthesis proteins [BR:ccaz01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     COUCH_31765 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  UQU63544 LinkDB All DBs Position complement(6880824..6881036) Genome browser AA seq 70 aa AA seqDB search MSSNPFDDENGTFHVLVNDEEQHSLWPAFKEIPSGWRSVFGPSSRQEALDYVDEHWTDLR PKSLRDSMAR NT seq 213 nt NT seq  +upstreamnt  +downstreamnt gtgtccagcaacccgttcgacgacgagaacggcaccttccacgtcctggtgaacgacgag gagcagcactccctctggccggcgttcaaggagatcccgtcgggctggcgcagcgtcttc ggcccctcgtcgcggcaggaggcgctggactacgtggacgagcactggaccgacctgcgc ccgaagagcctgcgcgacagcatggcccggtga

DBGET integrated database retrieval system