Clostridium cellulosi: CCDG5_0637 Help Entry CCDG5_0637        CDS       T03806                                  Name (GenBank) hypothetical protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism ccel  Clostridium cellulosi Pathway ccel00020   Citrate cycle (TCA cycle) ccel01100   Metabolic pathways ccel01110   Biosynthesis of secondary metabolites ccel01120   Microbial metabolism in diverse environments ccel01200   Carbon metabolism ccel01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:ccel00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     CCDG5_0637 Enzymes [BR:ccel01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      CCDG5_0637 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_6 Fer4_2 Fer4_7 Fer4_9 Fer4_10 Fer4_21 Fer4_15 Fer4_4 Fer4_22 Fer4_8 Fer4_16 Fer4_3 Fer4_17 Fer4_13 Motif Other DBs NCBI-ProteinID:  CDZ23767 UniProt:  A0A078KMK5 LinkDB All DBs Position I:complement(684692..684895) Genome browser AA seq 67 aa AA seqDB search MPKVTVNEDLCKGCGLCVTACPKKIMVLSDKLNKKGYHPAHVFEIEKCIGCAMCAVMCPD VAIKVEK NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgccaaaagtcactgtcaatgaagacttgtgcaaaggctgtggactgtgtgtaacagcc tgtccgaaaaaaattatggttctaagcgataagcttaacaaaaagggatatcacccggcc catgtctttgaaatcgaaaaatgcataggctgtgctatgtgtgccgttatgtgtcccgat gtcgccattaaagtcgaaaagtaa

DBGET integrated database retrieval system