Acetivibrio clariflavus: Clocl_1342 Help Entry Clocl_1342        CDS       T01661                                  Name (GenBank) hypothetical protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism ccl  Acetivibrio clariflavus Pathway ccl00020   Citrate cycle (TCA cycle) ccl01100   Metabolic pathways ccl01110   Biosynthesis of secondary metabolites ccl01120   Microbial metabolism in diverse environments ccl01200   Carbon metabolism ccl01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:ccl00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     Clocl_1342 Enzymes [BR:ccl01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      Clocl_1342 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_7 Fer4 Fer4_2 Fer4_21 Fer4_6 Fer4_10 Fer4_9 Fer4_4 Fer4_15 Fer4_8 Fer4_16 Fer4_17 Fer4_13 Fer4_3 Fer4_22 Fer4_18 Motif Other DBs NCBI-ProteinID:  AEV67993 UniProt:  G8M0E8 LinkDB All DBs Position 1551773..1551979 Genome browser AA seq 68 aa AA seqDB search MAKVTFHEERCKGCKLCTTVCPKKIVIMLEDKINQKGFHPAGVSDMDKCIGCAFCATICP DCVIEVEK NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atggctaaagtaacatttcatgaagaacgctgcaagggatgtaagttatgtacgactgta tgtccgaaaaaaattgttattatgctggaagataagataaatcaaaaaggcttccatccg gctggtgtatctgatatggacaaatgtatcggatgtgcattttgtgccactatatgtcct gattgcgtaattgaagttgaaaaataa

DBGET integrated database retrieval system