Campylobacter coli FB1: VC76_01880 Help Entry VC76_01880        CDS       T03870                                  Name (GenBank) Dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism ccof  Campylobacter coli FB1 Pathway ccof00790   Folate biosynthesis ccof01100   Metabolic pathways ccof01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:ccof00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     VC76_01880 Enzymes [BR:ccof01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      VC76_01880  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      VC76_01880  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      VC76_01880 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AJW57809 UniProt:  A0A400M1D6 LinkDB All DBs Position complement(362015..362332) Genome browser AA seq 105 aa AA seqDB search MQSHINIKMQFKCIIGILKFERKKKQKVCIYLTAKANDFLDYAKVSKKIKKYYKKEQFLT LEESLEFVCAKLHRKFPQIYYIKIKTYKPEIIKNARVGVKLKKFY NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgcaaagtcatataaatatcaaaatgcagtttaaatgcattataggaatattaaaattt gaacgcaagaaaaaacaaaaggtttgtatttatcttacagctaaagcaaatgatttttta gattatgccaaggtatcaaaaaaaatcaaaaaatactataaaaaagaacaatttcttacc ctagaagaatctttagaatttgtttgtgcgaaattacatagaaaatttccgcaaatttac tatattaaaatcaaaacttataaacctgaaataatcaaaaatgcaagagttggtgtaaaa ttaaaaaaattttattaa

DBGET integrated database retrieval system